I need help with 6 and 7 please help?

I Need Help With 6 And 7 Please Help?

Answers

Answer 1

Answer:

6-a .   7-c

Explanation:

Answer 2
6-a and 7-c I think that’s the answer

Related Questions

3. Water near the poles receives much less solar energy than the tropical regions and often has water temperatures around 0 degrees Celsius. Why is the water in the polar
regions not completely frozen?
A color
C salinity B density
D phytoplankton

Answers

Answer:

Yes

Explanation:

sdfu8hdfhu8dfghgdfijndfgjknfdgjknfgdjkndfgjkndfgklndfgknldfgklmdfgklmdfgkondfgkjnodfgklndfgklndfglknfgdklndfgklndfgklndfgklndfgklndfgpkmfgdklnfdgyklndklndfgklndfglkngdfklndfgljkngdfklndfglkmdfgh

I think c I’m not sure though :))

Four monitoring wells have been placed around a leaking underground storage tank. The wells are located at the corners of a 1-ha square. The total piezometric head in each of the wells is as follows: NE corner, 30.0 m; SE corner, 30.0 m; SW corner, 30.6 m: NW corner 30.6 m. Determine the magnitude and direction of the hydraulic gradient.

Answers

Answer:

direction : West to East

magnitude : 6.0 * 10^-3

Explanation:

Given data :

Four ( 4 ) monitoring wells

location of wells = corners of 1-ha square

Total piezometric head in each well ;

NE corner = 30.0 m ;

SE corner = 30.0 m;

SW corner = 30.6 m;

NW corner = 30.6 m.

Calculate for  the magnitude and direction of the hydraulic gradient

first step ; calculate for area

Area = ( 1 -ha  ) ( 10^4 m^2/ha )

        = 1 * 10^4 m^2

Distance between the wells = length of side

      = √( 1 * 10^4 ) m^2

      = 100 m

Direction of Hydraulic gradient is from west to east because the total piezometric head in the west = Total piezometric head in the east

Next determine The magnitude of the hydraulic gradient

= ( 30.6 - 30 ) / 100

= 6.0 * 10^-3

Which of these describes static electricity?

a temporary charge

a steady charge

plssssssssssssss answer correctly plsssssss correct answers only plsss not in a meen way thx

Answers

Answer:

A temporary charge

Explanation:

Static electricity is not steady. Unlike current electricity, it does not have a  driving force either in the form of a voltage source or an electromotive force from a cell or a generator. Static electricity is usually due a temporary flow of charges between bodies due unbalanced charges within a system, continuing  until equilibrium is achieved.

Answer:

a is correct

Explanation:

g Drop the object again and carefully observe its motion after it hits the ground (it should bounce). (Consider only the first bounce and do NOT assume the total energy is the same as the total energy of the object before it hits the ground.) a. List the quantities that you need to know to determine the total energy of the object after it hits the ground. b. Record your measurements and describe how you measured them. c. Calculate the total energy of the object after it hit the ground. Your final answer: ______________ d. Determine whether or not the object’s energy was conserved when it hit the ground. If it was not conserved, explain where the energy went.

Answers

Answer:

a) quantity to be measured is the height to which the body rises

b) weighing the body , rule or fixed tape measure

c)   Em₁ = m g h

d) deformation of the body or it is transformed into heat during the crash

Explanation:

In this exercise of falling and rebounding a body, we must know the speed of the body when it reaches the ground, which can be calculated using the conservation of energy, since the height where it was released is known.

a) What quantities must you know to calculate the energy after the bounce?

The quantity to be measured is the height to which the body rises, we assume negligible air resistance.

So let's use the conservation of energy

starting point. Soil

          Em₀ = K = ½ m v²

final point. Higher

          Em_f = U = mg h

         Em₀ = Em_f

         Em₀ = m g h₀

b) to have the measurements, we begin by weighing the body and calculating its mass, the height was measured with a rule or fixed tape measure and seeing how far the body rises.

c) We use conservation of energy

starting point. Soil

          Em₁ = K = ½ m v²

final point. Higher

          Em_f = U = mg h

         Em₁ = Em_f

         Em₁ = m g h

d) to determine if the energy is conserved, the arrival energy and the output energy must be compared.

There are two possibilities.

* that have been equal therefore energy is conserved

* that have been different (most likely) therefore the energy of the rebound is less than the initial energy, it cannot be stored in the possible deformation of the body or it is transformed into heat during the crash

please help me please just looking the picture​

Answers

the work done done by that person is less than zero

Noah Formula is riding an old-fashioned roller coaster. Noah encounters a small hill having a radius of curvature of 12.0 m. At the crest of the hill, Noah is lifted off his seat and held in the car by the safety bar. If Noah is traveling with a speed of 14.0 m/s, then use Newton's second law to determine the force applied by the safety bar upon Noah's 80-kg body.'

Answers

Answer:

1306.66N

Explanation:

Given data

r=12.0 m

v=14 m/s

m= 80kg

From the formula

F= mv^2/r

substitute

F= 80*14^2/12

F= 80*196/ 12

F= 15680/12

F=1306.66N

Hence the force applied is 1306.66N

A police car drives with a constant speed of 70km/hr. how long will it take to cover a distance of 135km?
(btw, it's a physics question:-)​

Answers

Explanation:

36. How long does it take a car to slow down from a speed of 54 km/h to 32 km/h over a distance of 65 m? Answer in seconds. 37.

What is the difference between temperature and heat???

Also what is calorimeter and Thermometer​

Answers

Answer:

Difference between heat and temperature in tabular form

Heat vs Temperature

1.Heat is a form of energy that can transfer from a hot body to a cold body. and Temperature is the degree of hotness and coldness of a body.

2.Heat is the total kinetic energy and potential energy obtained by molecules in an object. and Temperature is the average K.E of molecules in a substance.

3.Heat flows from hot body to cold body. It rises when heated and falls down when an object is cooled down and It has a working ability. It does not have the working ability

.

4.Its SI unit is “Joule” and Its SI unit is “Kelvin”.

5.It is measured by the calorimeter and It is measured by the thermometer

.

6.It is represented by “Q”. and It is represented by “T”.

Explanation:

A calorimeter is an object used for calorimetry, or the process of measuring the heat of chemical reactions or physical changes as well as heat capacity. ... A simple calorimeter just consists of a thermometer attached to a metal container full of water suspended above a combustion chamber.

Which is NOT a way to stay safe from static electricity?

a lightning rod on a building
a metal spike in an airport runway
an anti-static chain on a large truck
a run through an open field during a lightning

plssssssssssss answer not in a meen way but corrrect answer only plsssssssssssss answer correct i will drop a thx and rate yo stars ans give you brainlyest

Answers

a metal spike in an airport runway

A metal spike in an airport runway  is NOT a way to stay safe from static electricity. Hence option C is correct.

What is electricity ?

Electricity is a collection of physical phenomena related with the presence and motion of matter having an electric charge. Both electricity and magnetism are connected to the phenomena of electromagnetic, as defined by Maxwell's equations. Lightning, static electricity, electric heating, electric discharges, and other frequent occurrences are all connected to electricity.

An electric field is created when either a positive or negative electric charge is present. The movement of electric charges results in an electric current and a magnetic field. In most applications, a force of magnitude determined by Coulomb's law operates on a charge. Volts are commonly used to measure electric potential.

Hence option C is correct.

To know more about electricity :

https://brainly.com/question/12791045

#SPJ3.

how is sound produced by using stringed instrument​

Answers

sound vibrations

Explanation:

akechis pancakes

Answer:

By waves

Explanation:

when sound is being produced by string instruments it uses waves to help create that sound

A capacitor is made from two hollow, coaxial, iron cylinders, one inside the other. The inner cylinder is negatively charged and the outer is positively charged; the magnitude of the charge on each is 11.5 pC. The inner cylinder has a radius of 0.550 mm, the outer one has a radius of 7.20 mm, and the length of each cylinder is 13.0 cm.
(a) What is the capacitance?
(b) What applied potential difference is necessary to produce these charges on the cylinders?

Answers

Answer:

A)2.811 × 10^-12 F

B)4.09V

Explanation:

(a) What is the capacitance?

Capacitance of coaxial cylinder can be determined using below expresion

C= (2π ε0 L)/ Ln[ rb/ra]

Where

ε0= permittivity of free space= 8.85×10^−12 Fm^-1

L= length of each cylinder =13.0 cm= 13×10^-2m

rb= radius of outer cylinder= 7.20 mm= 7.20×10^-3m

ra=radius of inner cylinder=0.550 mm= 0.550×10^-3 m

If we substitute the values we have,

C= (2π ε0 L)/ Ln[ rb/ra]

C= ( 2 × π × 8.85×10^−12 ×13×10^-2) / Ln[

7.20×10^-3/0.550×10^-3]

C=( 7.2288×10^-12 )/2.5729

C=2.811 × 10^-12 F

B) (b) What applied potential difference is necessary to produce these charges on the cylinders?

Vba= Q/C

Where Vba=potential difference

Q= charge on each = 11.5 pC. = 11.5×10^-12

C= capacitance= 2.811 × 10^-12 F

If we substitute the values we have

Vba=(11.5×10^-12)/2.811 × 10^-12

= 4.09V

Suppose that 2 J of work is needed to stretch a spring from its natural length of 24 cm to a length of 42 cm. (a) How much work is needed to stretch the spring from 32 cm to 34 cm

Answers

Answer:

Workdone = 0.025 Joules

Explanation:

Given the following data;

Workdone = 2J

Extension = 42 - 24 = 18 cm to meters = 18/100 = 0.18m

The workdone to stretch a string is given by the formula;

Workdone = ½ke²

Where;

k is the constant of elasticity.

e is the extension of the string.

We would solve for string constant, k;

2 = ½*k*0.18²

2 = ½*k*0.0324

Cross-multiplying, we have;

4 = 0.0324k

k = 4/0.0324

k = 123.46 N/m

a. To find the workdone when e = 32, 34.

Extension = 34 - 32 = 2 to meters = 2/100 = 0.02m

Workdone = ½*123.46*0.02²

Workdone = 61.73 * 0.0004

Workdone = 0.025 Joules

Therefore, the amount of work (in J) needed to stretch the spring from 32 cm to 34 cm is 0.67.

4. A sodium ion has a +1 relative atomic charge which indicates it has one more proton than electron.
This ion is placed in a 4.00 NC electric field. Remember, the charge of one relative atomic charge is 1.60 x 10-19


a. Calculate the force applied to a single sodium ion in this electric field.

Answers

Answer:

a

Explanation:

All of the following are true statements regarding line-voltage thermostats and control wiring except a. An electrician's license is often required to run line-voltage control wiring. b. Line-voltage thermostats must be matched to the voltage and current of the circuit. c. Line-voltage thermostats and controls are not as sensitive as low-voltage thermostats. d. Line-voltage thermostats and controls respond faster than low-voltage thermostats.

Answers

Answer:

c. Line - voltage thermostats and controls are not as sensitive as low - voltage thermostats.

Explanation:

Line voltage thermostat is a regulator which senses the temperature and maintains it to keep the desired level of the voltage. The license in required for the electricians to work on the voltage control wirings. There is technical aspects which an electrician must understand before working on the circuits and voltage lines.

PLZ HELP ILL GIVE RBAINLIEST
Which of the following factors can affect the strength of electric or magnetic fields? (YOU MAY SELECT MORE THAN ONE ANSWER)

Strength of the magnet/electric charge

The material that is creating the field

The mass of the object creating the field

The distance from the source of the field

Answers

All of the above .........

If there are 10 Volts across a 5 Ohm resistor, what is the current?

Answers

Answer:

I = 2A

Explanation:

V = IR

10V = I × 5ohms

I = 2A

Answer:

2Ampere

Explanation:

V=IR (ohm's law) so I =[tex]\frac{V}{R}[/tex] =[tex]\frac{10}{5}[/tex]=2Ampere

In which situation is static electricity most likely to form?

Elizabeth switches on a light.
Jack holds a plastic comb close to a stream of water.
Marie drives a car.
Cooper bakes a cake. plssssssssssss answer not in a meen way but corrrect answer only plsssssssssssss answer correct i will drop a thx and rate yo stars ans give you brainlyest

Answers

Answer:

I'd go for 'Marie drives a car'

Explanation:

Static electricity will possible form in all the scenarios, but is more likely to form when you're driving a car. This is due to the friction between the body of the car and the particles in the air around the body of the car. This is why chains are sometimes attached to fuel tankers when transporting them. The chain is made to touch the ground so that any charge built up can be safely conducted to the earth, reducing the chances of a fire outbreak due to charges igniting the fuel.

Answer:

i think its a, sorry if im wrong

Explanation:

why is gravity on earth important

Answers

it holds down our atmosphere and the air we need to breathe- it holds our world together!

write the type of energy present in pond water and kerosene?​

Answers

Potential and kinetic energy

The energy present in pond water and kerosene are potential energy and chemical energy respectively.

What is energy?

Energy is a quantifiable quantity in physics that can be transferred from an item to do work. Thus, we might characterise energy as the capacity to engage in any kind of physical action. So, to put it simply, we can define energy as: Energy is the capacity to carry out work.

Energy "can neither be created nor destroyed but can only be changed from one form to another," according to the rules of conservation of energy. The SI unit for energy is called a joule.

In pond, water is stored during rain and stored potential energy whereas in kerosene, carbon molecules have chemical energy and when it burns, chemical energy revels as thermal energy.

Learn more about energy here:

https://brainly.com/question/1932868

#SPJ2

Expository essay "Climate change in Fiji"​

Answers

Answer: Climate change poses to the tourism development in Fiji islands. It shows the adverse effects of the changing climate and the dangers pose by the tourism activities and also pose a major hazard for the local people in the region. It also deals with the dangerous carbon emissions and CO2 effect on the landscape, food, water, energy.

The pacific is the world`s largest ocean with a surface area of 175 million sq km and constitutes for 40% of the planet`s waters. Located in the tropical latitudes, it covers more than half the globe`s circumference. Temperature of the surface water in the western tropical regions is always more than 28 ÌŠC over a depth of several hundred meters. This makes up the world`s storage of thermal energy for exchange with atmosphere. Here the interaction between atmosphere and ocean is most extreme and influences the climate not only regionally but planet-wide. The nations of the pacific are obscured human settlements absorbed in this vast fluid universe. The ocean is the most important factor controlling the environment and life.

Describe the phenomenon of lightning?​

Answers


Lightning is a naturally occurring electrostatic discharge during which two electrically charged regions in the atmosphere or ground temporarily equalize themselves, causing the instantaneous release of as much as one gigajoule of energy.

Will the 79 kg skier in the figure below slide down if f the coefficient of static friction is 0.25?

Answers

Answer:

Man will not slide down

Explanation:

Given:

Coefficient of static friction = 0.25

Angle = 13°

Computation:

Man will slide down if

tan13° > Coefficient of static friction

Tan 13 = 0.23

So,

0.23 < 0.25

So,

Man will not slide down

A resistor, an ideal capacitor, and an ideal inductor are connected in parallel to a source of an alternating voltage of 160 V at a frequency of 250 Hz. A current of 2 A flows through the resistor and a current of 0.8 A flows through the inductor. The total current through the circuit is 2.5 A. Assess the resistance of the resistor, the capacity of the ideal capacitor, and the inductance of the ideal inductor (presume that IC > IL).

Answers

Answer:

R = 46,25 (Ω)

L = 0,07363 (H)

C = 2,7 *10⁻⁶ (F)

Explanation:

Statement problem does not specify if  160 (V) is peak voltage or RMS value. If 160 (V) is the peak value then for a sinusoidal wave,  RMS value is  V(rms) = 160 /√3

V(rms) =  92,49 (V)

In each branch: we have

V = I*Z         V = voltage through the impedance in (V) , I current in (A)

and Z impedance in Ω

Resistor case    Z = R  then V = 92,49 = 2 * R

R = 92,49/2       R = 46,25 (Ω)

Inductor case   |Z| = wL    Then Z = 2*π*f*L   V = 0,8 * |wl|

Inductor L in (H)       |wL| * 0,8 = 92,49   |wL| = 92,5/0,8    w = 2*π*f   2*3,14*250= 1570

1570*L = 92,49/0,8

L = 0,07363 (H)

In the case of the capacitor

|Z|  = 1/wc    = 1/1570*c

The current is 2 + 0,8 = 2,8          2,8 - 2,5 = 0,3 (A)

Again  V = I*Z        92,49 = 0,3 /1570*C

C = 0,3 / 1570*92,49

C = 2,7 *10⁻⁶ (F)

distace x time graph will be ................ if the body is in ununiform motion​

Answers

A non-straight ... possibly a zig-zag, wiggly, curvy, or snaking ... line. But always rising.

Answer:

Uniform: Straight line; Non uniform: Curved.

Explanation:

Have a great day

A young parent is dragging a 65 kg (640 N) sled (this includes the mass of two kids) across some snow on flat ground, by means of a rope attached to the sled. The rope is at an angle of 30 degrees with respect to the ground and the tension in the rope is 160 N. The sled is moving at a constant velocity of 1.5 m/s.
(a) Draw and label all forces acting on the kids + sled system. Indicate the relative size of each force by scaling the length of each force arrow appropriately
(b) Calculate the normal force acting on the system
(c) Calculate the force of friction acting on the system.
(d) Calculate the coefficient of friction between the sled and the snow.

Answers

Answer:

b) N = 560 N, c)  fr = 138.56 N, d)  μ = 0.247

Explanation:

a) In the attachment we can see the free body diagram of the system

b) Let's write Newton's second law on the y-axis

              N + T_y -W = 0

              N = W -T_y

let's use trigonometry for tension

             sin θ = T_y / T

             cos θ = Tₓ / T

             T_y = T sin θ

             Tₓ = T cos θ

we substitute

              N = W - T sin 30

we calculate

              N = 640 - 160 sin 30

              N = 560 N

c) as the system goes at constant speed the acceleration is zero

X axis

              Tₓ - fr = 0

               Tₓ = fr

we substitute and calculate

              fr = 160 cos 30

              fr = 138.56 N

d) the friction force has the formula

             fr = μ N

             μ = fr / N

we calculate

             μ = 138.56 / 560

             μ = 0.247

What happens when you move two
objects far apart from each other?
A. The force of gravity increases.
B. The force of gravity decreases.
C. Distance does not affect the force of gravity.
D. The friction between the two objects will increase.

Answers

Answer:

b

Explanation:

B. The force of gravity decreases

A student sets up a standing wave of wavelength 6 meters in a coiled spring by moving his hand up and down twice each second. What is the velocity of the wave?

Answers

Answer:

Velocity = 12 m/s

Explanation:

Given the following data;

Wavelength = 6 meters

Period = 0.5 seconds. This is due to the fact that the student is moving his hand up and down twice each second.

To find the velocity;

Velocity = wavelength * frequency

But, frequency = 1/period

Frequency = 1/0.5

Frequency = 2

Substituting the values into the velocity formula, we have;

Velocity = 6 * 2

Velocity = 12 m/s

Therefore, the velocity of the wave is 12 meters per seconds.

An electric motor supplies 2,500 Watts of power in a 220 V circuit. What is the resistance of the motor? Be sure to include the proper units in your answer. Remember... Ω is the unit for Resistance.

Answers

Answer:

R = 19.36  ohms

Explanation:

Given that,

The power of an electric motor, P = 2500 Watts

The voltage of the circuit, V = 220 V

We need to find the resistance of the motor. We can find it as follows :

[tex]P=\dfrac{V^2}{R}\\\\R=\dfrac{V^2}{P}\\\\R=\dfrac{(220)^2}{2500}\\R=19.36\ \Omega[/tex]

So, the resistance of the motor is 19.36  ohms.

What is the rarefaction of a longitudinal
wave?
A. the place where the particles are closest together
B. the place where the particles are farthest apart
C. the resting position of the wave
D. how fast the parts of the wave move
Sea

Answers

The answer Is B! Good luck


C
D
7
The sun is the original source of
energy for many of our energy
resources
Which energy resource does not
originate from the sun? *
(1 Point)
.
A. Geothermal
B. Hydroelectric
C. Waves
D. Win

Answers

Answer:

geothermal

Explanation:

geothermal energy is the heat energy obtained from within the Earth. Hence not derived from Sun's energy.

Other Questions
HELP PLEASE!! i need help on A and B. PLEASE DONT ANSWER IF YOU DONT KNOW!! Please help will give brainliest Read the following sentence.The lightning danced across the night sky as we watched from our front porch.How is the lightning personified?A. It is described as dancing to show how it made the people move.B. It is described as dancing to show how it made the people feel.C. It is described as dancing to show how it looked to the people below.D. It is described as dancing to show how it sounded to the people below. laser light has a great deal of______ a. chemical b. heat c. potential d. sound energy.?? . What are some examples of how Roman philosophy and law influence us today? hola alguien que me ayudee!!esto es sobre el texto el principito sobre el capitulo numero 71. En el desierto, cul es la principal preocupacin del piloto?2. En qu est trabajando el piloto que cree que lo ayudar a salir del desierto?3. Por qu el principito se enfurece con el piloto del captulo 7?4. Cmo llama el principito al caballero de rostro colorado que es el hombre de negocios?5. Cmo llama Antoine de Saint-Exupry La tierra de las lgrimas? 6. En el quinto da que el piloto y el principito estn juntos, se revela el miedo secreto a la vida del principito. Cual es ese secreto? Find the area of the figure.5.5 cm6.5 cm22 cmThe area of the figure is How many hundreths are equivalent to three-quaters Solve this puzzleR+R Suppose the individuals making up a population of tree frogs came in avariety of colors.How does this type of diversity most likely affect the tree frog population?A. The frogs exhibiting different colors must compete fiercely withone another for resources.B. This type of diversity means that fewer individuals will survive ifthe environment changes.C. The colors help the frogs recognize and communicate with oneanotherD. The frogs are well adapted to different niches, minimizingcompetition Which transitions best clarify the sequence of events in this narrative?My best friend Darrin and I spent the morning riding roller coasters,high-flying swings, Tilt-A-Whirls, and gravity spinners. When our queasystomachs couldn't take it anymore, we headed to the animal exhibits.we crossed a bridge over a pond filled with giant goldfish.We'd never seen fish so big. We both leaned out as far as we could,fascinated by their bulging eyes and weird lips. In our fixated state, wedidn't notice that the railing was just for show, so when it gave way andsent us headfirst into the pond, we were completely surprised.park employees and security guards gathered at the pond'sedge. Darrin and I swam furiously for the shore, with the huge fishclose behind us. write the equation below in wordsz=(8-3)+10 6. The commander of the Portuguse army was Colombus true or false? 1213Rob paid $50.15 for two pairs of jeans, which include a 15% discount.What was the price of one pair of jeans before the discount was added? PLZ FASTWhich statement describes the historical legacy of Francis Xavier?Francis Xavier was against the Catholic Reformation and colonization.Francis Xavier reunified Spain and defeated the Ottomans.Francis Xavier established missions in North America.Francis Xavier spread Christianity to India and Asia Two runners ran side by side, each holding one end of a horizontal pole. How would this affect the direction of the runners? Explain. 3. If one side of the equation 23+43 = 66 is multiplied by 3, what needs to be done to the other side of the equation to keep the sides equal? PLEASE HELP !! 100 POINTS !! (and brainliest)Find the area for the following figure. Explain or show how you got your answer. Glucocorticoids are steroid hormones that control cellular responses through several different signaling pathways. One of the signaling pathways involves the glucocorticoid receptor, an intracellular protein that is activated by binding to a glucocorticoid molecule. A simplified model of the glucocorticoid receptor signaling pathway is represented in Figure 1.Which of the following statements best predicts the effect of a mutation that results in a loss of the glucocorticoid receptors ligand binding function? Aaron buys erasers for his pencils. Each eraser costs $0.20. The total cost is $1.20. How many erasers does Aaron buy? Solve this problem any way you choose.